PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.L02563.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 218aa    MW: 24854 Da    PI: 9.5941
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.L02563.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-171663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEde+l+ ++k++G  +W++ a+  g++R++k+c++rw +yl
  Eucgr.L02563.1.p 16 KGAWSAEEDEKLIAYIKRHGIWNWSRMAELAGLRRSGKSCRLRWMNYL 63
                      79******************99************************97 PP

2Myb_DNA-binding49.31.2e-1570112246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g++T+eE e+++++++ lG++ W++Ia+++  gRt++++k++w++
  Eucgr.L02563.1.p  70 GNFTKEEVEIIIKLHEVLGNK-WSAIASKLV-GRTDNEVKNYWHT 112
                       89*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7611163IPR017930Myb domain
SuperFamilySSF466894.67E-2914110IPR009057Homeodomain-like
SMARTSM007172.6E-131565IPR001005SANT/Myb domain
PfamPF002495.8E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-231770IPR009057Homeodomain-like
CDDcd001671.07E-101863No hitNo description
PROSITE profilePS5129423.83564118IPR017930Myb domain
SMARTSM007171.0E-1468116IPR001005SANT/Myb domain
PfamPF002491.2E-1370112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2471117IPR009057Homeodomain-like
CDDcd001672.26E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MAELGVVLDE KGSLRKGAWS AEEDEKLIAY IKRHGIWNWS RMAELAGLRR SGKSCRLRWM  60
NYLRPNLRHG NFTKEEVEII IKLHEVLGNK WSAIASKLVG RTDNEVKNYW HTRLKKRFKG  120
KPMQKPRKSE AARVSNSVDA NHESSSQGEE VQLLNLGDFT GNPTSTPDNF CASSSNQAIG  180
VPGDKEKSFE NNLCSSYVDD KFQSYLWAQH FSVEDAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26141185108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010041850.11e-160PREDICTED: myb-related protein Myb4-like
SwissprotO496084e-47MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A059CBQ51e-130A0A059CBQ5_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s14140.16e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-48myb domain protein 15